Dear Monks,
another newbie here, trying to make sense of the hashes and how to best use them (if this is what I need) for my following problem:
Assume the following file, where each 'entry' has 3 lines, namely:

>id_1|id_2
sequence_of_chars
label_of_chars
[download]

Now, what I want is to store the unique entries, and, by unique in my case i define the ones that have the same id_2 and sequence_of_chars. The label_of_chars does not matter much, as it will only vary a little bit if the other 2 lines are the same. The only change (and I don't care which one I keep of those) is the id_1, where I can have multiple ones. Example below:

>4kt0_M|P72986
MALSDTQILAALVVALLPAFLAFRLSTELYK
iiiiiiiiiMMMMMMMMMMMMMMMMMIIIII
>6uzv_m|P72986
MALSDTQILAALVVALLPAFLAFRLSTELYK
iiiiiiiiiiiiMMMMMMMMMMMMMMMMMII
>5oy0_m|P72986
MALSDTQILAALVVALLPAFLAFRLSTELYK
iiiiiiiiiMMMMMMMMMMMMMMMMMIIIII
>6hqb_M|P72986
MALSDTQILAALVVALLPAFLAFRLSTELYK
iiiiiiiiiiiMMMMMMMMMMMMMMIIIIII
[download]

Now, from the example above, the desired output would be any of the 4kt0_M, 6uzv_m, 5oy0_m or 6hqb_M and then |P72986, the sequence MALSDTQILAALVVALLPAFLAFRLSTELYK below this and any of the 4 available labels. Is hashes the way to go? I can split the line starting with > and store each of the 4 elements into variables, but I don't know how to proceed from there.

---

---

• Are you posting in the right place? Check out Where do I post X? to know for sure.
• Posts may use any of the Perl Monks Approved HTML tags. Currently these include the following:

  <code> <a> <b> <big> <blockquote> <br /> <dd> <dl> <dt> <em> <font> <h1> <h2> <h3> <h4> <h5> <h6> <hr /> <i> <li> <nbsp> <ol> <p> <small> <strike> <strong> <sub> <sup> <table> <td> <th> <tr> <tt> <u> <ul>

• Snippets of code should be wrapped in <code> tags not <pre> tags. In fact, <pre> tags should generally be avoided. If they must be used, extreme care should be taken to ensure that their contents do not have long lines (<70 chars), in order to prevent horizontal scrolling (and possible janitor intervention).
• Want more info? How to link or How to display code and escape characters are good places to start.