Beefy Boxes and Bandwidth Generously Provided by pair Networks
Welcome to the Monastery
 
PerlMonks  

comment on

( #3333=superdoc: print w/replies, xml ) Need Help??
#!/usr/bin/perl use strict; # https://perlmonks.org/?node_id=11152595 use warnings; my $input = <<END; >4kt0_M|P72986 MALSDTQILAALVVALLPAFLAFRLSTELYK iiiiiiiiiMMMMMMMMMMMMMMMMMIIIII >6uzv_m|P72986 MALSDTQILAALVVALLPAFLAFRLSTELYK iiiiiiiiiiiiMMMMMMMMMMMMMMMMMII >5oy0_m|P72986 MALSDTQILAALVVALLPAFLAFRLSTELYK iiiiiiiiiMMMMMMMMMMMMMMMMMIIIII >5oy0_m|P72986 MALSDTQILDIFFERENTAFLAFRLSTELYK iiiiiiiiiMMMMMMMMMMMMMMMMMIIIII >7oy0_m|P72996 MALSDTQILAALVVALLPAFLAFRLSTELYK iiiiiiiiiMMMMMMMMMMMMMMMMMIIIII >6hqb_M|P72986 MALSDTQILAALVVALLPAFLAFRLSTELYK iiiiiiiiiiiMMMMMMMMMMMMMMIIIIII END my %unique; for ( split /(?=>)/, $input ) { $unique{ join "\n", (split /[|\n]/)[1, 2]} //= $_; } use Data::Dump 'dd'; dd sort values %unique;

Outputs:

( ">4kt0_M|P72986\nMALSDTQILAALVVALLPAFLAFRLSTELYK\niiiiiiiiiMMMMMMMMM +MMMMMMMMIIIII\n", ">5oy0_m|P72986\nMALSDTQILDIFFERENTAFLAFRLSTELYK\niiiiiiiiiMMMMMMMMM +MMMMMMMMIIIII\n", ">7oy0_m|P72996\nMALSDTQILAALVVALLPAFLAFRLSTELYK\niiiiiiiiiMMMMMMMMM +MMMMMMMMIIIII\n", )

In reply to Re: How to make unique entries by tybalt89
in thread How to make unique entries by Anonymous Monk

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post; it's "PerlMonks-approved HTML":



  • Are you posting in the right place? Check out Where do I post X? to know for sure.
  • Posts may use any of the Perl Monks Approved HTML tags. Currently these include the following:
    <code> <a> <b> <big> <blockquote> <br /> <dd> <dl> <dt> <em> <font> <h1> <h2> <h3> <h4> <h5> <h6> <hr /> <i> <li> <nbsp> <ol> <p> <small> <strike> <strong> <sub> <sup> <table> <td> <th> <tr> <tt> <u> <ul>
  • Snippets of code should be wrapped in <code> tags not <pre> tags. In fact, <pre> tags should generally be avoided. If they must be used, extreme care should be taken to ensure that their contents do not have long lines (<70 chars), in order to prevent horizontal scrolling (and possible janitor intervention).
  • Want more info? How to link or How to display code and escape characters are good places to start.
Log In?
Username:
Password:

What's my password?
Create A New User
Domain Nodelet?
Chatterbox?
and the web crawler heard nothing...

How do I use this?Last hourOther CB clients
Other Users?
Others cooling their heels in the Monastery: (5)
As of 2023-12-09 11:54 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?
    What's your preferred 'use VERSION' for new CPAN modules in 2023?











    Results (38 votes). Check out past polls.

    Notices?