use strict;
use warnings;
use LWP;
my $base_url = 'http://dis.embl.de';
my $protein = 'MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI';
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  "$base_url/cgiDict.py", # That's the URL that the real form submits to.
  [
    key             => 'process',
    SP_entry        => '',
    sequence_string => $protein,
    smooth_frame    => '8',
    peak_frame      => '8',
    join_frame      => '4',
    fold_coils      => '1.20',
    fold_rem465     => '1.20',
    fold_hotloops   => '1.40',
    plot_title      => '',
    doApplet        => 'true',
    tango_PH        => 7.40,
    tango_T         => 298.15,
    tango_I         => 0.02,
    tango_TFE       => 0.00,
    fold_tango      => 1.00,
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $html = $response->content;
my ($eps) = ( $html =~ m{<a href="([^"]+)">Download PostScript file</a>} )
  or die;

$response = $browser->get("$base_url/$eps");
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $out_path = 'tmp.eps';
open my $out_fh, '>', $out_path
  or die "Can't write-open out_file: $!";
print {$out_fh} $response->content;
close $out_fh;
system( 'C:/Program Files/Ghostgum/gsview/gsview32.exe', $out_path );