Help for this page

Select Code to Download


  1. or download this
    >sp|P09153|TFAE_ECOLI Prophage tail fiber assembly protein homolog Tfa
    +E OS=Escherichia coli (strain K12) OX=83333 GN=tfaE PE=1 SV=2
    MHKAILNSDLIATKAGDVTVYNYDGETREYISTSNEYLAVGVGIPACSCLDAPGTHKAGY
    ...
    LKAKCIYIHRLKKGFSTTHPLLNKEVQALKNWLSIRTSYPHAESEWVFLSRKGNPLSRQQ
    FYHIISTSGGNAGLSLEIHPHMLRHSCGFALANMGIDTRLIQDYLGHRNIRHTVWYTASN
    AGRFYGIWDRARGRQRHAVL
    
  2. or download this
    print "This script will count the number of amino acids\n\n";
    use strict;
    ...
    print $out_file "A=$A C=$C D=$D E=$E F=$F G=$G H=$H I=$I K=$K L=$L M=$
    +M N=$N P=$P Q=$Q R=$R S=$S T=$T V=$V W=$W Y=$Y ";
    print "\n";
    print "done";
    
  3. or download this
    A=61 C=10 D=31 E=40 F=18 G=41 H=23 I=39 K=28 L=57 M=11 N=24 P=21 Q=27 
    +R=37 S=36 T=35 V=23 W=11 Y=27