Re^2: calculation of charged amino acids

Replies are listed 'Best First'.
Re^3: calculation of charged amino acids by mtmcc (Hermit) on Jul 23, 2013 at 11:11 UTC
When I run that program on these fasta sequences: >DROTME_HH_Q02936 MRHIAHTQRCLSRLTSLVALLLIVLPMVFSPAHSCGPGRGLGRHRARNLY PLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDE >DROME_HH_Q02937 MRHIAHTQRCLSRLTSLVALLLIVLPMVFSPAHSCGPGRGLGRHRARNLY PLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEE GTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLTTTTTTESWDEDYHHGQ YEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSDSS ESLH >DROME_HH_Q02938 GTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLTTTTTTESWDEDYHHGQ YEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSDSS ESLH I get this output: Name: >DROME_HH_Q02937 Number of acidic amino acids:33 Number of basic amino acids:35 Number of neutral amino acids:33 Name: >DROME_HH_Q02938 Number of acidic amino acids:18 Number of basic amino acids:17 Number of neutral amino acids:18 Name: >DROTME_HH_Q02936 Number of acidic amino acids:14 Number of basic amino acids:18 Number of neutral amino acids:14 The fasta tags for each protein must be unique.	[reply]
Re^4: calculation of charged amino acids by yuvraj_ghaly (Sexton) on Jul 24, 2013 at 04:52 UTC
are these fasta sequences in one file file or different??? Paste all these sequences in one file, save in fasta format and then run the program. You will see the problem	[reply]
Re^5: calculation of charged amino acids by mtmcc (Hermit) on Jul 24, 2013 at 05:58 UTC
They're all in one file. I don't see the problem I'm afraid. If you like though, you could tell me what problem you're having.	[reply]
A reply falls below the community's threshold of quality. You may see it by logging in.
Re^3: calculation of charged amino acids by yuvraj_ghaly (Sexton) on Jul 24, 2013 at 04:50 UTC
so u used the same code which I input	[reply]