in reply to Re^6: Correct link to put in my WWW:Mechanize
in thread Correct link to put in my WWW:Mechanize

Yes, of course, I added some:
my $url = 'http://www.csbio.sjtu.edu.cn/cgi-bin/MEMBRAIN.cgi';
my $mech = WWW::Mechanize->new (timeout=>1000);
$mech->get($url);

        $mech->submit_form
        (
            form_number => 1,
            fields      => 
            {
                #textarea name | value
                S1 => ">$id\n$seq",

                #Radio button name | prediction type
                R4    =>  TOPpre,

                #Radio button SIGNAL | I do not know if I have a signa
+l peptide
                R2    =>  SignalYES,

                #Radio button ORGANISM | Human, Plant, Animal, OEuk, G
+pos, Gneg, 
                R3    =>  Human,

                #Fill in email
                email => 'testmail@gmail.com'
            }
        );

[download]

Replies are listed 'Best First'.
Re^8: Correct link to put in my WWW:Mechanize
by bliako (Abbot) on Mar 13, 2022 at 12:14 UTC

    Your code is bad. You need to quote strings (hash values). Additionally S1 parameter looks a bit strange with the new line embedded - are you sure?

    Here is the curl equivalent of a successful run I did earlier (I broke the lines for readability). You can see that by opening developer tools on Firefox. I have done a successful submission using this from a Linux terminal:

    curl 'http://www.csbio.sjtu.edu.cn/cgi-bin/MEMBRAIN.cgi' -H 'User-Agen
+t: XXX'
-H 'Accept: text/html,application/xhtml+xml,application/xml;q=0.9,imag
+e/webp,*/*;q=0.8'
-H 'Accept-Language: en-US,en;q=0.5' --compressed
-H 'Referer: http://www.csbio.sjtu.edu.cn/bioinf/MemBrain/'
-H 'Content-Type: application/x-www-form-urlencoded'
-H 'Origin: http://www.csbio.sjtu.edu.cn'
-H 'DNT: 1' -H 'Connection: keep-alive' -H 'Upgrade-Insecure-Requests:
+ 1'
--data-raw 'mode=string&S1=NTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAI
WFLNLAVADFLACLALPALFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKPAW
CQRFRGAGLAWILCAVAWGLALLLTIPSALYRVVREEYFPPKVLCGVDHDKRRERAVAIVRLVLGFLWPL
LTLTICYTFILLRTWSARETRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKLDSLCV
+S
FAYINCCINPIIYVVAGQGFQKSLPELLREVLTEESVVR&R5=on&S2=&R4=TOPpre&TOPpre=on
&R2=SignalYES&R3=Human&email=abc%40xyz.com&B1=Submit'

    [download]

    You can infere a couple of things from the above: 1) the correct POST params from --data-raw. 2) No cookies are required. So either continue with Mech but use the correct url and POST params or use LWP::UserAgent with a browser-like user-agent string

    sarcasm on: if the cgi script you are accessing is also programmed by biologists all bets are on (off, whatever).

    bw, bliako

[reply]
[d/l]
[select]
Re^8: Correct link to put in my WWW:Mechanize
by LanX (Saint) on Mar 12, 2022 at 19:15 UTC
    you are still confusing the two URIs, see my explanation here.

    The form is a part of the page you get°

    Maybe you should read up on some HTTP/HTML basics first.

    Cheers Rolf
    (addicted to the Perl Programming Language :)
    Wikisyntax for the Monastery

    °) that's the address you see in your browser, mechanize will extract the address of the CGI automatically if you specify which form to use.

[reply]
      There is only one form on the page, so I thought it's enough what I write... Usually I had been able to use this script with minimal alterations, for instance for this page:
      http://www.compgen.org/tools/PRED-TMBB2

      [download]

      (does not have CGI this one). So I think my confusion is created because of the CGI thing.
[reply]
[d/l]
        WWW::Mechanize shows everything in the synopsis.

        adjust this 

        use WWW::Mechanize ();
my $mech = WWW::Mechanize->new();
 
$mech->get( $url );   # the address in your browser

 
$mech->submit_form(
    form_name => 'search',                         # the form name in 
+the code
    fields    => { query  => 'pot of gold', },     # parameters
    button    => 'Search Now'                      # button
);

        [download]

        I'm AFK now, TTYL.

        Cheers Rolf
        (addicted to the Perl Programming Language :)
        Wikisyntax for the Monastery

[reply]
[d/l]

In Section Seekers of Perl Wisdom