Hi there Monks!
So, I am new to Perl and I need to create a script that can send data to a webpage (it's a tool that I need for my research) and then, when the service finishes running, get the results.
The web-tool is this:
http://www.csbio.sjtu.edu.cn/bioinf/Signal-3L/

[download]

and to see the results, you can use this example sequence:
MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTM SAETMELRWVS
+SSLRQVVNVYADGKEVEDRQSAPYRGRTSIL

[download]

So, I need first to select one of the radio-buttons, then paste the sequnce in the textarea, then press Submit and then, in the results page, either download it or "read" the result, which, in this example is:
According to Signal-3L engine for your selected species, the signal pe
+ptide is:1-42

[download]

Can you give me hints/links on where to start? Because there are quite a few tools that I need to run through the web and it would be easier to know how to do it.
Thank you!

In reply to Perl script for running a CGI-BIN service over the web by Anonymous Monk

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.