Hello Monks, Am a beginner. I have two files, the first (file1) contains several rexeges, while the other(file2) contains FASTA sequences . My intention is to use the regex in file1 to check if they match any Fasta sequences in file2 and print any regexes that match atleast one sequence, with the number of sequences they match.

file1 is structured in such a way that each line has an ID, followed by '>>', then the regex; 
e.g    FGER_HWW_PRT >> ..DW[ALK]..[^P]..[VI]{2,4}
    TKAR_GLW_NQW >> [^VKR]{0,2}..FP[D].T.N.Q.

    etc...

[download]
file2 has the an idenfier on one line and the sequence on the next; 
e.g     >lac9_B: details details

    GFVTSDRWPALKMSRWSLEMVWASRGYPLVNDRMWSWSDDDP
    >serP_A: otherdetails details2
    GFVLSDPPPPALKMSRWSLEMVWASRGYPLVNDPWQRTKRKRKDRTCWASNYIHDRP

[download]
Many thanks.

In reply to How do i use regexes in one file to match FASTA sequences in another file by mind_frame

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.