Here's another option:

use strict;
use warnings;

local $/ = '>';

while (<>) {
    chomp;
    /\S/ or next;
    my ( $id, $seq ) = /(.+?)\n(.+)/s;
    $seq =~ s/\n//g;

    my $GCcount = $seq =~ tr/GC//;
    printf "%s, %.2f%%\n", ">$id", ( $GCcount / length $seq ) * 100;
}

[download]

Command-line usage: perl script.pl fastaFile [>outfile]

The last, optional parameter directs output to a file.

Sample FASTA record:

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY

[download]

Output on that sample FASTA record:

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus], 7.3
+9%

[download]

Since FASTA files use ">" as the record separator, the script sets Perl's record separator to that character, so the file's read one FASTA record at a time. After a read, chomp removes that record separator.

Next, /\s/ tests to see that there are characters to parse and, if not, the next record is read. Using a regex, the id and seq are captured. A substitution is used to remove any newlines, so an accurate length count can be made. (The sequence in FASTA records may be across multiple lines; this script will handle these.)

As AnomalousMonk demonstrated, Perl's transliteration operator can be used to get the GC character count within the sequence. Finally, the results are printed using printf.

Hope this helps!

In reply to Re: Problem computing GC content by Kenosis
in thread Problem computing GC content by zuepinhel

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.