Use a flip-flop to detect you're inside the correct sequence. Accumulate the sequence in a variable, use matching in scalarised list context to get the number of occurrences (the Goatse/Saturn operator). If the patterns can overlap, use a look-ahead instead of a plain match. 
#! /usr/bin/perl
use warnings;
use strict;
use feature qw{ say };

my $seq;
while (<DATA>) {
    if (my $line_number = (/^>JJ22$/ ... /^>/)) {
        chomp;
        $seq .= $_ unless $line_number == 1 || $line_number =~ /E0/;
    }
}
my $count = () = $seq =~ /[MT].[KA]/g;
say $count;

__DATA__
>JJ57
MKIKLVTVGDAKEEYLIQGINEYLKRLNSYAKRETIEVPDEKAPEKLSDAEMLQVKEKEGEYVFVLAI
NGKQLSSEEFSKEIFQTGISGKSNLTFTTCFSLGLSDSVLQRIMKGEPYHKL
>JJ22
MDQNGASGSHPNRASTRKGAHARERGATVSAMSANRSNIIDEMAKICEADRQTFAIARRTRNESQ
FFGFRTASNKAIEITEAMEKRGAMFLTQSKATDQLNGWQPSDEPDKTSAESEPWFRGKQLSSEEFS
KEIFQTGISGKSNLTFTTCFSLGLSDSVLQRIMKGEPYHKL
>JJ41
MWKTVAPIFAAIFAVGLCGTFRTNTRKGEPTTKCFVFVHDTKARIYQCTFKTWSCPWLNNIVSAQF
QFVTGANYKIVVKLVGELFTETALFNWSSPTTIFTGLGTLITADKTLDCDSNML

[download]

The first check in the unless part excludes the header, the E0 is appended to the last line number, so it excludes the next header.

map{substr$_->[0],$_->[1]||0,1}[\*||{},3],[[]],[ref qr-1,-,-1],[{}],[sub{}^*ARGV,3]

In reply to Re: Find a sequence in a multifasta files and motifs by choroba
in thread Find a sequence in a multifasta files and motifs by rebkirl

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.