You can count the number of occurrences of a particular character in a string with tr:

use 5.010;                                                            
+          

my $str1 = 'MALSSTAATTSSKLKLSNPPSLSHTFTASASASVSNSTSFR';

my $a_count = $str1 =~ tr/A/A/; # 6

[download]

length will give you the length of the entire string.

Now to actually pull out the uppercase sequence from your sample input, are you reading lines from a file? Something like this would probably work:

#!/usr/bin/env perl

use 5.010;

for (<>) {
    if (/^>/) {
        # Header
    } elsif (/^[A-Z]+$/) {
        # Protein
        my $a = tr/A/A/;
        say "A: $a, length: " . length;
    }
}

[download]

Then simply run it with script.pl < protein.txt. Modify the say ... line to taste, or more likely, replace it with the rest of your logic. You can also choose to parse the header if needed, in the # Header section.

You could of course modify this to actually open the file in your script with open instead, if that is more desirable:

open my $fh, '<', $filename
    or die "Couldn't open $filename: $!";

for (<$fh>) {

[download]
use strict; use warnings; omitted for brevity.

In reply to Re: How to count the length of a sequence of alphabets and number of occurence of a particular alphabet in the sequence? by rjt
in thread How to count the length of a sequence of alphabets and number of occurence of a particular alphabet in the sequence? by davi54

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.