I'm sorry I did not include my subroutines in the previous message. But, I am counting the length of the sequence in the subroutine but it's not working yet. I tried your suggestion as follows:

#!/usr/bin/perl
use strict;
use warnings;
use autodie;

print 'Please enter protein sequence filename: ';
chomp( my $prot_filename = <STDIN> );

open my $PROTFILE, '<', $prot_filename;

my $report_name = "${prot_filename}_alanine_report";
open my $out_file, '>', $report_name;

my $rx_fasta_header = qr{ \A > }xms;  # header pattern - very naive
my $rx_sequence     = qr{ \A [ACDEFGHIKLMNPQRSTVWY_]+ \z }xms;  # plea
+se check
my $rx_blank_line   = qr{ \A \s* \z }xms;

my $sequence;  # sequence accumulator - initially undefined

RECORD:
while (my $record = <$PROTFILE>) {

    # handle any records to be ignored here
    next RECORD if $record =~ $rx_blank_line;

    chomp $record;  # get rid of newline, if any

    # fasta header - process any sequence accumulated so far
    if ($record =~ $rx_fasta_header) {
       
        # do not process if no sequence accumulated so far (i.e., firs
+t header)
        next RECORD if not defined $sequence;
       
        do_something_with($sequence, $out_file);
       
        undef $sequence;  # prepare to process next sequence
        next RECORD;
       
        }

    # part of sequence - accumulate
    if ($record =~ $rx_sequence) {
        $sequence .= $record;  # accumulate sub-sequences (records)
        next RECORD;
        }

    die "bad record: '$record'";  # don't know what this is

    }  # end while RECORD loop

# handle any sequence accumulated from final FASTA record
do_something_with($sequence, $out_file) if defined $sequence;

# clean up
close $PROTFILE;
close $out_file;

exit;

# subroutines #

sub do_something_with {

    my ($sequence,  # accumulated sequence
        $fh,        # output filehandle
        ) = @_;

    my $seq_len = length $sequence;
    }
[download]

But I'm getting the error - bad record: 'SRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANLVVVMGGNAAEAHPVG' at ../alanine_vs_sequence_length_3.pl line 47, <$_...> line 1370. And I get this error for both your and my script. Does it have something to do with the "die" command on line 47 as it is pointing out?

---

---

Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!

Titles consisting of a single word are discouraged, and in most cases are disallowed outright.

Read Where should I post X? if you're not absolutely sure you're posting in the right place.

Please read these before you post! —

• How do I compose an effective node title?
• How do I post a question effectively?
• Markup in the Monastery

Posts may use any of the Perl Monks Approved HTML tags:

a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr

You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)

	For:		Use:
	&		&
	<		&lt;
	>		&gt;
	[		&#91;
	]		&#93;

Link using PerlMonks shortcuts! What shortcuts can I use for linking?

See Writeup Formatting Tips and other pages linked from there for more info.