#!/usr/bin/perl -CSDA 

use utf8;
use Modern::Perl;
no warnings qw{uninitialized};
use Data::Dumper;
use Path::Tiny;

my $data = path('file,fasta')->slurp_utf8() =~ s/\s//mgr;
warn $data; 

print $data =~ /$_/  
        ? "The protein contains the domain -- $_\n"
        : "The protein doesn't contain the domain -- $_\n"
for 'KCKQCGKGFSRRSALNV', 'CGK', 'XXXX';

for my $lookfor (qw{CGK SQRLNR SQR PYKC PYKCK}) {
        pos $data = 0;
        while ($data =~ /$lookfor/gc) {
                print "there is $lookfor at ", (pos $data), "\n";
        }
}



result: 

AAF88103.1zincfingerprotein226[Homosapiens]MNMFKEAVTFKDVAVAFTEEELGLLGP
+AXRKLYRDVMVENFRNLLSVGHPPFKQDVSPIERNEQLWIMTTATRRQGNLGEKNQSKLITVQDRESEE
+ELSCWQIWQQIANDLTRCQDSMINNSQCHKQGDFPYQVGTELSIQISEDENYIVNKADGPNNTGNPEFP
+ILRTQDSWRKTFLTESQRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNM
+KILTFDHNSMIHTGQKSYQCNECKKPFSDLSSFDLHQQLQSGEKSLTCVERGKGFCYSPVLPVHQKVHV
+GEKLKCDECGKEFSQGAHLQTHQKVHVIEKPYKCKQCGKGFSRRSALNVHCKVHTAEKPYNCEECGRAF
+SQASHLQDHQRLHTGEKPFKCDACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGFICSSNLYIHQRVH
+TGEKPYKCEECGKGFSRPSSLQAHQGVHTGEKSYICTVCGKGFTLSSNLQAHQRVHTGEKPYKCNECGK
+SFRRNSHYQVHLVVHTGEKPYKCEICGKGFSQSSYLQIHQKAHSIEKPFKCEECGQGFNQSSRLQIHQL
+IHTGEKPYKCEECGKGFSRRADLKIHCRIHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEEC
+GKSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKYFSQASSLQLH
+QSVHTGEKPYKCDVCGKVFSRSSQLQSHQRVHTGEKPYKCEICGKSFSWRSNLTVHHRIHVGDKSYKSN
+RGGKNIRESTQEKKSIK at ./a.pl line 10.
The protein contains the domain -- KCKQCGKGFSRRSALNV
The protein contains the domain -- CGK
The protein doesn't contain the domain -- XXXX
there is CGK at 357
there is CGK at 385
there is CGK at 441
there is CGK at 469
there is CGK at 497
there is CGK at 525
there is CGK at 553
there is CGK at 581
there is CGK at 637
there is CGK at 665
there is CGK at 693
there is CGK at 721
there is CGK at 749
there is CGK at 777
there is CGK at 805
there is SQRLNR at 229
there is SQR at 226
there is PYKC at 380
there is PYKC at 464
there is PYKC at 492
there is PYKC at 548
there is PYKC at 576
there is PYKC at 632
there is PYKC at 716
there is PYKC at 744
there is PYKC at 772
there is PYKC at 800
there is PYKCK at 381

[download]

In reply to Re^2: Finding pattern in a file by leszekdubiel
in thread Finding pattern in a file by shabird

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.