G'day davi54,

"I want to count the number of alphabets in each entry, length of each entry, etc."

That's confusing as you combine the counts for all entries in @count. Other variables, outside the while loop, appear misplaced as they look like they're associated with individual entries: I'd expect them to be inside the while loop.

The following code collects all the data that I believe you want. You can combine values for all entries if necessary.

#!/usr/bin/env perl use strict; use warnings; my %results; { local $/ = ''; while (my $record = <DATA>) { $record =~ s/\A>(.+?)$//m; my $entry = $1; $record =~ s/\s//gm; $results{$entry}{len} = length $record; for (0 .. $results{$entry}{len} - 1) { ++$results{$entry}{count}{substr $record, $_, 1}; } } } use Data::Dump; dd \%results; __DATA__ >sp_0005 VQLQESGGGLVQAGGSLRLSCAASGRAVSMYNMGWFRQAPGQERELVAAISRGGSIYYA DSVKGRFTISRDNAKNTLYLQMNNLKPEDTGVYQCRQGSTLGQGTQVTVSS >sp_0017 HVQLVESGGGSVQAGGSLRLTCAASGFTFSNYYMSWVRQAPGKGLEWVSSIYSVGSNGYY ADSVKGRSTISRDNAKNTLYLQMNSLKPEDTAVYYCAAEPGGSWWDAYSYWGQGTQVTVS S

Extract of output:

{ sp_0005 => { count => { A => 9, C => 2, ..., W => 1, Y => 5, }, len => 110, }, sp_0017 => { count => { A => 10, C => 2, ..., W => 5, Y => 10, }, len => 121, }, }

Notes:

— Ken


In reply to Re: Count the sequence length of each entry in the file by kcott
in thread Count the sequence length of each entry in the file by davi54

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":



  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.