"for the first entry, the sequence length value you get in your output (110) is one less than the actual sequence length which is 111." 
$ perl -E 'say length "VQLQESGGGLVQAGGSLRLSCAASGRAVSMYNMGWFRQAPGQERELV
+AAISRGGSIYYA"'
59

$ perl -E 'say length "DSVKGRFTISRDNAKNTLYLQMNNLKPEDTGVYQCRQGSTLGQGTQV
+TVSS"'
51

$ perl -E 'say 59+51'
110

[download]

If you add the newline between those two strings you'll get 111 for \n or 112 for \r\n. There's also whitespace after those strings which will further increase the length of the line. As I already stated, you posted your data as paragraph text: I can't tell what the original data was.

I removed all whitespace in my code: 

$record =~ s/\s//gm;

[download]

The correct length, after removing white space, is 110.

— Ken

In reply to Re^3: Count the sequence length of each entry in the file by kcott
in thread Count the sequence length of each entry in the file by davi54

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.