Actually, the input file is ... [update: quoted from this post]

Rather than saying (update: in a different post!) what your example data actually is, why not post that data as it actually is, in a form immediately usable by other monks (who are trying to help you). That is, use <code> ... </code> tags to post your data, maybe something like: 

<code>
>sp_0005_SySynthetic ConstructTumor protein p53 N-terminal transcripti
+on-activation domain
VQLQESGGGLVQAGGSLRLSCAASGRAVSMYNMGWFRQAPGQERELVAAISRGGSIYYA
DSVKGRFTISRDNAKNTLYLQMNNLKPEDTGVYQCRQGSTLGQGTQVTVSS

>sp_0017_CaCamelidSorghum bicolor multidrug and toxic compound extrusi
+on sbmate
HVQLVESGGGSVQAGGSLRLTCAASGFTFSNYYMSWVRQAPGKGLEWVSSIYSVGSNGYY
ADSVKGRSTISRDNAKNTLYLQMNSLKPEDTAVYYCAAEPGGSWWDAYSYWGQGTQVTVS
S
</code>

[download]
In addition to being your exact example data, this data is easily [download]-able by anyone who might want to help with this problem. You might want to add this <code>-tagged example data as an update (see How do I change/delete my post?) to your original post in addition to finally updating this post, or at the very least update this post and add to the OP a note saying that example data can be found there.

Please see Markup in the Monastery, Writeup Formatting Tips and What shortcuts can I use for linking to other information?, and perhaps some of the articles in the Understanding and Using PerlMonks section of the Monastery's Tutorials.

Update: Some trivial wording changes; added links to actual "Actually..." post.

Give a man a fish:  <%-{-{-{-<

In reply to Re^3: Count the sequence length of each entry in the file (updated) by AnomalousMonk
in thread Count the sequence length of each entry in the file by davi54

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.