Hi, I have a file containing names of contigs eg.

contig_188
contig_222
contig_19
[download]

I also have another genbank file which looks like

//
LOCUS       A08_contig188            628 bp    DNA     linear   UNK
DEFINITION  Contig A08_contig131 from balbla
ACCESSION   unknown
FEATURES             Location/Qualifiers
     source          1..628
                     /mol_type="genomic DNA"
                     /db_xref="taxon: 6666666"
                     /genome_md5=""
                     /project="luke_6666666"
                     /genome_id="6666666.23054"
                     /organism="blabla"
     CDS             complement(144..614)
                     /db_xref="GO:0003723"
                     /db_xref="GO:0005525"
                     /db_xref="GO:0006605"
                     /db_xref="GO:0006614"
                     /db_xref="GO:0016020"
                     /translation="MGDIVSLVEKAAQDLGEENLKKAEENLKKGQFSME
+DYLSQLRQM
                     KKMGGIEGIMSFMPGVSKIKSQMDSAGIDESIITKNEAIILSMTKKERE
+NPKIIDGSR
                     KKRIANGSGSDPATINKLLKQFKMMSEMMKKMSKGNLKGMSDKGIPPEL
+FNQLK"
                     /product="Signal recognition particle, subunit Ff
+h SRP54
                     (TC 3.A.5.1.1)"
BASE COUNT      168 a    132 c     76 g    252 t
ORIGIN
        1 tagtagaggg ttaaaaaaac caaccttctc tataaatctt ccgtcccttg caaaa
+cgact
       61 gtcggcaaca acaaccttat aaacaggacg tttttttgtt ccacctcttg ataat
+cttaa
      121 ttttaacatt tcttctcctt tttttacttt aattggttaa atagctctgg cggta
+taccc
      181 ttgtcagaca tacctttcag atttccttta gacatctttt tcatcatttc agaca
+tcatt
      241 ttaaattgct taagcaattt attgatagtg gctggatctg agccagagcc attag
+caatt
      301 cttttttttc tagaaccatc tattattttt gggttctctc tttctttttt tgtca
+ttgat
      361 aaaataatag cttcattttt agtaattata ctttcgtcaa ttcccgctga gtcca
+tttga
      421 gatttaattt tagaaactcc tggcataaaa gacataattc cctcaatgcc accca
+ttttt
      481 ttcatctgtc ttaattgaga caaataatct tccatagaga attgaccttt tttta
+aattt
      541 tcctctgctt ttttaagatt ttcttctcct aaatcttgag ccgccttttc tacaa
+gggat
      601 acaatatccc ccatacctag tattctgt
//
LOCUS       A08_contig131            628 bp    DNA     linear   UNK
DEFINITION  Contig A08_contig131 from blabla
ACCESSION   unknown
FEATURES             Location/Qualifiers
     source          1..628
                     /mol_type="genomic DNA"
                     /db_xref="taxon: 6666666"
                     /genome_md5=""
                     /project="luke_6666666"
                     /genome_id="6666666.23054"
                     /organism="blabla"
     CDS             complement(144..614)
                     /db_xref="GO:0003723"
                     /db_xref="GO:0005525"
                     /db_xref="GO:0006605"
                     /db_xref="GO:0006614"
                     /db_xref="GO:0016020"
                     /translation="MGDIVSLVEKAAQDLGEENLKKAEENLKKGQFSME
+DYLSQLRQM
                     KKMGGIEGIMSFMPGVSKIKSQMDSAGIDESIITKNEAIILSMTKKERE
+NPKIIDGSR
                     KKRIANGSGSDPATINKLLKQFKMMSEMMKKMSKGNLKGMSDKGIPPEL
+FNQLK"
                     /product="Signal recognition particle, subunit Ff
+h SRP54
                     (TC 3.A.5.1.1)"
BASE COUNT      168 a    132 c     76 g    252 t
ORIGIN
        1 tagtagaggg ttaaaaaaac caaccttctc tataaatctt ccgtcccttg caaaa
+cgact
       61 gtcggcaaca acaaccttat aaacaggacg tttttttgtt ccacctcttg ataat
+cttaa
      121 ttttaacatt tcttctcctt tttttacttt aattggttaa atagctctgg cggta
+taccc
      181 ttgtcagaca tacctttcag atttccttta gacatctttt tcatcatttc agaca
+tcatt
      241 ttaaattgct taagcaattt attgatagtg gctggatctg agccagagcc attag
+caatt
      301 cttttttttc tagaaccatc tattattttt gggttctctc tttctttttt tgtca
+ttgat
      361 aaaataatag cttcattttt agtaattata ctttcgtcaa ttcccgctga gtcca
+tttga
      421 gatttaattt tagaaactcc tggcataaaa gacataattc cctcaatgcc accca
+ttttt
      481 ttcatctgtc ttaattgaga caaataatct tccatagaga attgaccttt tttta
+aattt
      541 tcctctgctt ttttaagatt ttcttctcct aaatcttgag ccgccttttc tacaa
+gggat
      601 acaatatccc ccatacctag tattctgt
//
[download]

I would like to grep only the genbank contig information which matches the first file (list of contig names) and write it into a new file.. Anyone can help?

---

---

Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!

Titles consisting of a single word are discouraged, and in most cases are disallowed outright.

Read Where should I post X? if you're not absolutely sure you're posting in the right place.

Please read these before you post! —

• How do I compose an effective node title?
• How do I post a question effectively?
• Markup in the Monastery

Posts may use any of the Perl Monks Approved HTML tags:

a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr

You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)

	For:		Use:
	&		&
	<		&lt;
	>		&gt;
	[		&#91;
	]		&#93;

Link using PerlMonks shortcuts! What shortcuts can I use for linking?

See Writeup Formatting Tips and other pages linked from there for more info.