Dear monks, I have an array of sequences, each with a unique id. I'm trying to extract those sequences based on id's in a second array. The problem is that I am extracting them in the order they appear in the sequence array, not the order in the second array (which is what I want). How can I alter my code to extract ther sequences based on the order they appear in array2? Thanks!
Sequence file (@array1) looks like this: >gi|13470331|ref|NP_101896.1| hypothetical protein MFWVTKKALMPFLMLPAGIIFVSAVGYAINWLFSTLFQFQPPLVEGPAGPVTVLIFTITMLLAYDISYYL >gi|13470319|ref|NP_101897.1| hypothetical protein MGAYCQAHPACKVTDRTVIGRRDAAMNAPFVLAIPRTRTFEVVTSAARLAEIAPAWTALWQRAGGLVFQH my @array2 = qq(13470319 13470331 15460001 13490216); foreach my $line (@array1) { if ($line =~ /^gi\|(\d+)/) { for (my $i=0;$i<@array2; $i++) { if ($array2[$i] == $1) { print "$line "; } } } }

In reply to retrieving in the correct order by Anonymous Monk

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":



  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.