hi

im new to perl and have learnt the basics of it.. okay so i have this problem in bioinformatics in which i need to automate a process.

This is the process. theres this online tool called BIMAS

http://bimas.dcrt.nih.gov/molbio/hla_bind
 I paste a protein sequence ( Which is just a sequence of letters) and the program returns a html page with the results

this is a sample sequence which can be pasted and the results got
EALLKQSWEVLKQNIPGHSLCLFALIIEAAPESKYVFSFLKDSNEIPENNPKLKAHAAVIFKTICESATE
LRQKGQAVWDNNTLKRLGSIHLKNKITDPHFEVMKGALLGTIKEAVKENWSDEMCCAWTEAYNQLVATIK
AEMKE

[download]


There are more than 1000 such sequences and they are available as a single file with all the sequences.

i need a program to automate this process of feeding the data to the online tool and getting the results ( probable in a text file.) how do i go about doing this?? plzz help! will be extremely grateful !

i hope u get my problem.. if not will be happy to post a better description!
arvind

Edit: g0n - code tags around sample data

In reply to bioinformatics problem by mutatedgene

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.