hi all, i need a small clarification in the following program. i have a datafile like this. 
ENTRY            CCHU       #type complete
TITLE            cytochrome c [validated] - human
         Homo sapiens
ORGANISM         #formal_name Homo sapiens #common_name man
ACCESSIONS       A31764; A05676; I55192; A00001
MGDVEKGKKIFIMKCSQCHTVEMGDVEKGGKHKTGPNLHGMIYARAJLFGRKTSEKGQAPGYSYTAANKN
+KGIIWGEDTLMEYLENPKKYIP
ENTRY            CCCZ       #type complete
TITLE            cytochrome c - chimpanzee (tentative sequence)
ORGANISM         #formal_name Pan troglodytes #common_name chimpanzee
ACCESSIONS       A00002
GDVEKGKKIFIMKCSQCHTSEKVEKGSSSKHKSSSTGPNLHGLMIYARAJFGRKTGSEKQAPGYSYTAAN
+KNKGIIWGED
ENTRY            CCMQR      #type complete
TITLE            cytochrome c - rhesus macaque (tentative sequence)
         Macaca mulatta 
ORGANISM         #formal_name Macaca mulatta #common_name rhesus macaq
+ue
ACCESSIONS       A00003
GDVEKGKKIFIMKCSQSEKCHTVEKGGSSSSKHKTGPNLHGSSEKEMIYARAJKSEKLFGAAAAAAAARK
+TGQAPGYSYTAANKSSSSNKGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEE
ENTRY            CCMKP      #type complete
TITLE            cytochrome c - spider monkey
ORGANISM         #formal_name Ateles sp. #common_name spider monkey
ACCESSIONS       A00004
GDVFKGKRIFIMKCSQCHTVESSSSKGGKHKTGPNLHGLMIYARAJSEKFGSSSSSSSSSSR

[download]
i have written a program to save each and every line in a seperate array. this is the program 
open (PIR,'/home/guest/sampir.txt');
my @arr = ();
while (<PIR>)
{
    chomp;
    if( /^ENTRY/ ) { $entry = $_ }
    elsif ( /^(TITLE)\s+(\S.*)/ ) { $title = "$1\n\t $2" }
    elsif ( /^(ORGANISM)\s+(\S.*)/ ) { $org = "$1\n\t $2" }
    elsif ( /^ACCESSIONS/ ) { $acc = $_ }
    else {
        push @se, $_;
    }
}

[download]
but the line which is under the TITLE heading is not giving the 2nd line of its data. instead it gives only the first line. eg; when i print the title of the first entry it prints only "cytochrome c validated - human "and its not printing the second line "Homo sapiens"... How do i print the second line too in the same first line? plz help out. thanks.

In reply to doubt in storing a data of 2 lines in an array. by heidi

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.