Hello people....

I am just a beginner in Perl Scripting...... Please help me out in writing a script for this Query.... I have dataset at the bottom of this page....

This data shows some gene sequences of bacteria. Normally our task is to analysis sequences ranging from few 1,000 - 10,000 at a time....

Problems: There are number of duplicates in the dataset with the same Id..

To Solve....

I need to compile a code which can eliminate the redundancy and preserve on one copy of the gene sequence... ( For ex. 49329899 should occur only once in the dataset...... )

The alphabets present in the 2nd and 3rd line should also be preserved in the dataset.....

Below example have two records of “gi|49329899” 

Data.txt  
>gi|49329899|gb|AAT60545.1| chitinase [Bacillus thuringiensis serovar 
+konkukian str. 97-27
MLNKFKFICCTLVIFLLLPLAPFQAQAANNLGSKLLVGYWHNFDNGTGIIKLRDVSPKWDVINVSFGETG
GDRSTVEFSPVYGTDAEFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKQRFINSIQSLIDKYGFDGI
 
>gi|49330053|gb|AAT60699.1| chitinase [Bacillus thuringiensis serovar 
+konkukian str. 97-27
MKSKKFTLLLLSLLLFLPLFLTNFITPNVVLADSQKQDQKIVGYFPSWGIYGRNYQVADIDASKLTHLNY
AFADICWNGKHGNPSTHPDNPNKQTWNCKESGVPLQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDK
 
>gi|49478343|ref|YP_037789.1| chitinase [Bacillus thuringiensis serova
+r konkukian str. 97-27]
MLNKFKFICCTLVIFLLLPLAPFQAQAANNLGSKLLVGYWHNFDNGTGIIKLRDVSPKWDVINVSFGETG
GDRSTVEFSPVYGTDAEFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKQRFINSIQSLIDKYGFDGI
 
>gi|49329899|gb|AAT60545.1| chitinase [Bacillus thuringiensis serovar 
+konkukian str. 97-27
MLNKFKFICCTLVIFLLLPLAPFQAQAANNLGSKLLVGYWHNFDNGTGIIKLRDVSPKWDVINVSFGETG
GDRSTVEFSPVYGTDAEFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKQRFINSIQSLIDKYGFDGI
 
>gi|49478497|ref|YP_034712.1| chitinase [Bacillus thuringiensis serova
+r konkukian str. 97-27]
MKSKKFTLLLLSLLLFLPLFLTNFITPNVVLADSQKQDQKIVGYFPSWGIYGRNYQVADIDASKLTHLNY
AFADICWNGKHGNPSTHPDNPNKQTWNCKESGVPLQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDK
YARCGNFGELKRLKAKYPHLKTIISVGGWTWSNRFSDMAADEKTRKVFADSTVDFLREYGFDGVDLDWEY

[download]
Thanks in advance kenin

In reply to How to eliminate redundancy in huge dataset (1,000 - 10,000) by Kenin

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.