Perhaps something along the lines of 
#!/usr/bin/perl

use warnings;
use strict;

my (@peptide, @cds);
while (my $line = <DATA>){
  next unless $line =~ /^>/;
  chomp $line;
  chomp(my $seq = <DATA>);
  if ($line =~ /peptide/){
    push @peptide, $line, $seq;
    # or print to file handle
  }
  elsif ($line =~ /CDS/){
    push @cds, $line, $seq;
    # or print to file handle
  }
}

print qq{$_\n} for @peptide;
print qq{---\n};
print qq{$_\n} for @cds;

__DATA__
GENSCAN 1.0 Date run: 11-Mar-109  Time: 00:29:37

Sequence scaffold_2 : 47583 bp : 37.42% C+G : Isochore 1 ( 0 - 100 C+G
+%)

Parameter matrix: test.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -   2604   2462  143  0  2   77   96   184 0.883  20.81
 1.00 Prom -   3677   3638   40                               2.82

 2.00 Prom +   4382   4421   40                               1.62
 2.01 Init +   6395   6399    5  1  2   73   84     0 0.122  -0.16
 2.02 Intr +   8270   8412  143  2  2   74   82   110 0.141  12.00
 2.03 Term +   8516   8523    8  0  2   46   46     0 0.473  -8.05
 2.04 PlyA +   9723   9728    6                               2.27

Predicted peptide sequence(s):

Predicted coding sequence(s):


>scaffold_2|GENSCAN_predicted_peptide_1|48_aa
MDRSHQIWDEKLMDQKCVLYPVCLWHEQESEMNWEAEKAERLRTEQKX

>scaffold_2|GENSCAN_predicted_CDS_1|144_bp
atggatcggagtcatcagatatgggatgagaagctgatggatcagaagtgcgtcctctac
cccgtctgcctctggcacgagcaggagagcgagatgaactgggaggctgagaaagctgag
aggctaaggactgaacagaaaggn

>scaffold_2|GENSCAN_predicted_peptide_2|51_aa
MRKNEGVDDADPLIEGMKEITLKDSATPEDKDQEDKQDERGEEIQEQPQEM

>scaffold_2|GENSCAN_predicted_CDS_2|156_bp
atgaggaagaatgagggtgttgatgatgcagatccactaatagaaggtatgaaggagatc
actctgaaagattcagcaactccagaagacaaggatcaagaagacaaacaagatgagaga
ggtgaagaaattcaagaacaacctcaagagatgtag

[download]
>scaffold_2|GENSCAN_predicted_peptide_1|48_aa
MDRSHQIWDEKLMDQKCVLYPVCLWHEQESEMNWEAEKAERLRTEQKX
>scaffold_2|GENSCAN_predicted_peptide_2|51_aa
MRKNEGVDDADPLIEGMKEITLKDSATPEDKDQEDKQDERGEEIQEQPQEM
---
>scaffold_2|GENSCAN_predicted_CDS_1|144_bp
atggatcggagtcatcagatatgggatgagaagctgatggatcagaagtgcgtcctctac
>scaffold_2|GENSCAN_predicted_CDS_2|156_bp
atgaggaagaatgagggtgttgatgatgcagatccactaatagaaggtatgaaggagatc

[download]

In reply to Re: parsing sequences from a file by wfsp
in thread parsing sequences from a file by sugar

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.