Everyone learns by making mistakes. Demonstrate you can learn from those, and you will be well-regarded on this forum.

If you post input and desired output (good), make sure they correspond. In this case, only including the first section of output would have been appropriate, so the two match up.

I believe this works closer to your spec; it clears the contents of $header after the first print, so it will only appear once. 

#!/usr/bin/perl
use strict;
use warnings;

local $/; # Slurp
my $content = <DATA>;

my ($header) = $content =~ /^(>.*?\n)/m;
while ($content =~ /^[\w]*?([VMFWLCA]{8,})[\w]*?$/mg) {
    my $sequence = $1;
    print $header, "contains $sequence at position ", pos($content) - 
+length($sequence), "\n";
    $header = "";
}
__DATA__
>P30450 | Homo sapiens (Human). | NCBI_TaxID=9606; | 365 | Name=HLA-A;
+ Synonyms=HLAA;M

MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDT
QFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGS
TIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKW
ETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATL
RCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQ
RYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKS
SDRKGGSYSQAASSDSAQGSDMSLTACKVVAVLMLCLAVIFLC

[download]

outputs: 

>P30450 | Homo sapiens (Human). | NCBI_TaxID=9606; | 365 | Name=HLA-A;
+ Synonyms=HLAA;M
contains AVVAAVMW at position 420
contains VVAVLMLCLAV at position 461

[download]

Note I've changed you + to * so that your regular expression can also match entries at the start and ends of lines, not just in the middle. I assume this was an oversight on your part; sorry if this assumption is incorrect.

In reply to Re^5: need help with a regex by kennethk
in thread need help with a regex by aquinom

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.