It's possible because my regex didn't work with your reformatted FASTA records. :) aaron_baugher's suggestion to repost your records using <code> or <pre> was spot on, and helped with crafting the following new-and-improved solution--after your re-posting:

use strict;
use warnings;

my %FASTAhash;

{
    local $/ = '>';
    open my $file, '<FASTA.txt' or die $!;
    while (<$file>) {
        next if !/(.*?)\n/;
        chomp( $FASTAhash{$1} = $' )
          if !$FASTAhash{$1}
              or length $' > length $FASTAhash{$1};
    }
}

print ">$_\n$FASTAhash{$_}" for keys %FASTAhash;

[download]

Within a block, we start by letting perl know that '>' is the new record separator, instead of the default "\n" (so we read the file a FASTA record at a time, instead of a line at a time), and then tweaked the regex a bit to grab the ID.

You'll note that we don't use close $file; when we're done, since the file's automatically close when my $file falls out of scope (when the block ends).

Here's the output:

>ENSG00000147724
MSEIQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASIAGQTESSSLHSA
CVHDSTVHSRVFQILYRNEEVPINDAVVFRVHLLLGGERMEDALSEVDFQLKVDLHFTDS
EQQLRDVAGAPMVSSRTLGLHFHPRNGLHHQVP
>ENSG00000067082
Sequence unavailable
>ENSG00000010072
MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQ
LEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFV
TNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYY
GYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKD
KPNRGEAQLVIPFSGKGYVLGETSNLPSPGKLITSHAINKTQDLLNQNHSANAVRPNSKI
KVKFEQNGSSKNSHLVSPAVSNSHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIP
KNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDTFPNKRPRLEDKTVFDNF
FIKKEQIKSSGNDPKYSTTTAQNSSSSSSQSKMVNCPVCQNEVLESQINEHLDWCLEGDS
IKVKSEESL*

[download]

Hope this version's helpful!

Update: After posting the above, just noticed aaron_baugher's solution using $/ = '>' and I think this makes good sense, since this is the FASTA record delimiter.

In reply to Re^3: Saving different values for the same key by using Hash of Arrays by Kenosis
in thread Saving different values for the same key by using Hash of Arrays by beginner27

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.