in reply to retrieving in the correct order

or, if the first array is really a text file, say on a UNIX/LINUX system, you could cat the first file and read it line by line.. no? 
the scanning perl program gen.pl:
---------------------------------
#!/usr/bin/perl
use strict;
my @array = qw(13470319 13470331 15460001 13490216);
my @array2;

while(my $line =  <> ) {
    foreach my $id (0..$#array) {
        $array2[$id]=$line if $line =~  m/^gi\|($array[$id])\|/;
    }
}
print "order: ", join (" ", @array), "\n";
map {print} @array2;
-------------------------------
the text file:
gi|13470331|ref|NP_101896.1| hypothetical protein
MFWVTKKALMPFLMLPAGIIFVSAVGYAINWLFSTLFQFQPPLVEGPAGPVTVLIFTITMLLAYDISYYL
gi|13470319|ref|NP_101897.1| hypothetical protein
MGAYCQAHPACKVTDRTVIGRRDAAMNAPFVLAIPRTRTFEVVTSAARLAEIAPAWTALWQRAGGLVFQH
-------------------------------
the execution:
# cat gen.txt | perl gen.pl
order: 13470319 13470331 15460001 13490216
gi|13470319|ref|NP_101897.1| hypothetical protein
gi|13470331|ref|NP_101896.1| hypothetical protein

[download]

this just looked like a quick and keep it simple job to me..

UPDATE: updated the code to display correct order..

--
to ask a question is a moment of shame
to remain ignorant is a lifelong shame

Replies are listed 'Best First'.
Re^2: retrieving in the correct order
by Animator (Hermit) on Dec 16, 2004 at 21:02 UTC

    I think you are missing the point...

    If I understand the poster correctly then he (or she) wants to output them in the order they appear in the second array, so in this case first line/element 13470319, after that line/element 13470331 and so on

[reply]
      aah.. oops.. indeed i understood wrongly.

      update: and wisdom came to me :-D check the above code... simple, line by line and in the correct order. this time i tested the code ;-)

      --
      to ask a question is a moment of shame
      to remain ignorant is a lifelong shame
[reply]

In Section Seekers of Perl Wisdom