perl.crazy has asked for the wisdom of the Perl Monks concerning the following question:

Dear All, I am wiling to aumtomate a website using LWP. But the output is error message "Moved Temporarily". My program is as follows: 
********************************************
#!/usr/bin/perl

my $URLtoPostTo="http://tools.immuneepitope.org/tools/bcell/bcell_Pred
+iction";


my %Fields = (
   "swId"  =>  "P02185",
   "sequence" => ">sp|P02185|MYG_PHYCA Myoglobin OS=Physeter catodon G
+N=MB PE=1 SV=2
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE
DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG",
   "method" => '5'
);

use strict;
use LWP::UserAgent;
use HTTP::Request::Common;

my $Browser = new LWP::UserAgent;
if($BrowserName) { $Browser->agent($BrowserName); }

my $Page = $Browser->request(POST $URLtoPostTo,\%Fields);

if ($Page->is_success)
{
        print $Page->content;
}
else
{
        print "HTTP request failure \n";
        print $Page->message;
}

**********************************************************

[download]

Please let me know if there is any solution for this program. I am not able to find out.

Replies are listed 'Best First'.
Re: LWP problem
by Gangabass (Vicar) on Sep 18, 2009 at 11:52 UTC

    You should use:

    push @{ $Browser->requests_redirectable }, 'POST';

    [download]

    but i'm strongly recommend you to use WWW::Mechanize because life is short :-)

[reply]
[d/l]
Re: LWP problem
by Anonymous Monk on Sep 18, 2009 at 11:31 UTC
[reply]
Re: LWP problem
by venkatesan_G02 (Sexton) on Sep 18, 2009 at 11:59 UTC
    Try this code. It's retrieving the page but the link itself is throwing error "Error: please select a prediction method!". 
    #!C:/perl/bin/perl.exe

use LWP::UserAgent;
use HTTP::Request::Common;


my $url = 'http://tools.immuneepitope.org/tools/bcell/bcell_Prediction
+';


# Set up the ntlm client and then the base64 encoded ntlm handshake me
+ssage 
my $ua = new LWP::UserAgent();
    

$request = GET $url;
print "--Performing request now...-----------\n";                 
$response = $ua->request($request); 
                    

print "--Done with request-------------------\n";                 

if ($response->is_success) {print "It worked!->" . $response->code . "
+\n"}  

else {print "It didn't work!->" . $response->code . "\n"}             
+      


#Save the case to the local PC                            

$response = $ua->mirror($url,"c:/test/perlmonks.htm");

    [download]
    I would suggest using WWW::IE::MechanizeWWW::IE::Mechanize or WWW::SeleniumWWW::Selenium as the page uses Javascript.
[reply]
[d/l]
      Maybe you can replicate the error if you actually POST instead of GET :=D
[reply]
        It still gives the same result. It is fetching the page.
[reply]

Back to Seekers of Perl Wisdom