in reply to Beginner Hash Element Comparison

I have an array that looks like this (but with way more lines of sequence):

>memar0003 aminotransferase, class I and II (2259..3419)
LRDFVSKRARAIPPSGIRKFFDIAQTMEDVISLGVGEPDFVTPWCVCEAS
IYSIEQGSTAYTSNKGTPRLRAAISRYLDTRFSTHYDPEAEIIVTCGVSE
AADIAIRAVTDPGDEILVAEPCYVSYNPCVSLAGGTPVPVLCRAEDEFRL
That's not an array.

Replies are listed 'Best First'.
Re^2: Beginner Hash Element Comparison
by nicol004@uwp.edu (Initiate) on Feb 27, 2011 at 23:01 UTC
    How would you indicate to others that there are line breaks
    there at the end of each line?
    When the file is read in the new lines at the end separate out into separate
    elements of the array.
    So I would put the html form for a break in there in a post?
[reply]
      How would you indicate to others that there are line breaks there at the end of each line?
      What's that got to do with it?

      You posted a blob of text. Blobs of text aren't arrays. Perhaps the blob of text is what the array elements consist of. But as presented, it's a blob of text. It could be just a single array element, each character could be an array element, or it maybe something in between. 

      @this_is_an_array = ("look, text", "fragments, each inside", "quotes",
+ ", and separated by commas");

      [download]
[reply]
[d/l]
        Point taken.
[reply]
      For the case of "others" where "others" are Monks in the Monastery, please enclose you data snippets with code tags ... the way you formatted your script.

      For broader exposure -- the .html you mentioned -- you might want to use break tags or pre tags.

[reply]

In Section Seekers of Perl Wisdom