naka has asked for the wisdom of the Perl Monks concerning the following question:
I have never made a script in my life. The ploblem is how to change the fasta names like this input file:
>Glyma04g14800|Glyma04g14800.3
MMLETVAAVPGMVAGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYE
>Glyma05g24460|Glyma05g24460.1
SNVSIDLTKHHVPKNFLDKVAYRTVKLLRIPTDLFFKRRYGCRAMMLETVAAVPGMVGGM
in this output file (change original names to numbers in ascending order, starting with 1):
>1
MMLETVAAVPGMVAGMLLHCKSLRRFEHSGGWIKALLEEAENERMHLMTFMEVAKPKWYE
>2
SNVSIDLTKHHVPKNFLDKVAYRTVKLLRIPTDLFFKRRYGCRAMMLETVAAVPGMVGGM
I'm so grateful for helping. Regards, Naka
|
|---|
| Replies are listed 'Best First'. | |
|---|---|
|
Re: rename FASTA
by toolic (Bishop) on Sep 19, 2012 at 14:45 UTC | |
|
Re: rename FASTA
by Cristoforo (Curate) on Sep 19, 2012 at 22:10 UTC | |
by naka (Initiate) on Sep 21, 2012 at 14:29 UTC |