Hi, I have a very basic question. So, I have a list of protein sequences, where each entry has a header followed by the actual sequence. Say for example, two of the entries have the same word in the header:

>sp|O24310|EFTU_PEA Elongation factor Tu, chloroplastic OS=Pisum sativum OX=3888 GN=TUFA PE=2 SV=1

MALSSTAATTSSKLKLSNPPSLSHTFTASASASVSNSTSFR

>sp|Q43467|EFTU1_SOYBN Elongation factor Tu, chloroplastic OS=Glycine max OX=3847 GN=TUFA PE=3 SV=1

MAVSSATASSKLILLPHASSSSSLNSTPFRSSTTNTHKLTP

So, as highlighted, both these entries have GN=TUFA in their header. So, I want to write a script which can read the value of GN for all entries and removes all the following entries that have the same value for GN, either it be TUFA or any other value. And write the output to a file. Can anyone please help me?


In reply to remove entries with duplicate characters by davi54

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":



  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.