Hi, I have a very basic question. So, I have a list of protein sequences, where each entry has a header followed by the actual sequence (all uppercase alphabet sequence) and separated from the next entry with a blank new line (as shown in the example below). Is there a way where the script reads the uppercase sequence and outputs the length of the sequence and the number of times the alphabet A occurs in that sequence? So, for the two example sequences below:


>sp|O24310|EFTU_PEA Elongation factor Tu, chloroplastic OS=Pisum sativum OX=3888 GN=TUFA PE=2 SV=1

MALSSTAATTSSKLKLSNPPSLSHTFTASASASVSNSTSFR


>sp|Q43467|EFTU1_SOYBN Elongation factor Tu, chloroplastic OS=Glycine max OX=3847 GN=TUFA PE=3 SV=1

MAVSSATASSKLILLPHASSSSSLNSTPFRSSTTNTHKLTPADSTHNIKL


I want the output to look like:


Sequence: MALSSTAATTSSKLKLSNPPSLSHTFTASASASVSNSTSFR

Length: 41

A: 6


Sequence: MAVSSATASSKLILLPHASSSSSLNSTPFRSSTTNTHKLTPADSTHNIKL

Length: 50

A: 5


Any help would be appreciated. Thank you so much.


In reply to How to count the length of a sequence of alphabets and number of occurence of a particular alphabet in the sequence? by davi54

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":



  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.