hello monks, I am having a text file which has 270600 INPUT SEQUENCE in a single text file, so i want to split it into seperate by spliting up of 1000 INPUT SEQUENCE in a file. how to split a single file into many files.my file structure is as follows. 
INPUT SEQUENCE=6618
>P40757|ALN_RANCA Allantoinase, mitochondrial precursor - Rana catesbe
+iana (Bull frog)
MALKSKPGIMNITPGSKISVIRSKRVIQANTISSCDIIISDGKISSVLAWGKHVTSGAKLLDVGDLVVMA
GIIDPHVHVNEPGRTDWEGYRTATLAAAAGGITAIVDMPLNSLPPTTSVTNFHTKLQAAKRQCYVDVAFW
GGVIPDNQVELIPMLQAGVAGFKCFLINSGVPEFPHVSVTDLHTAMSELQGTNSVLLFHAELEIAKPAPE
IGDSTLYQTFLDSRPDDMEIAAVQLVADLCQQYKVRCHIVHLSSAQSLTIIRKAKEAGAPLTVETTHHYL
SLSSEHIPPGATYFKCCPPVRGHRNKEALWNALLQGHIDMVVSDHSPCTPDLKLLKEGDYMKAWGGISSL
QFGLPLFWTSARTRGFSLTDVSQLLSSNTAKLCGLGIVKEPLKWVMMLIWSSGILTKSFRCKKMIFITRI
SSPHIWDSFFKEKSWLLLFEGLLFISKGSMLPNQLENLFLYTLWSLVKPVHPVHPIIRKNLPHI
                                                                      
+                                                                     
+                  
Total Number of residues in the sequence =484
----------------------------------------------------------------------
+-----------------------------------
Number of residues in the repeat = 5
AAAAG                                                               96
+ to 100
AAAGG                                                               97
+ to 101
----------------------------------------------------------------------
+-----------------------------------
Number of residues in the repeat = 7
AGVAGFK                                                            157
+ to 163
GGISSLQ                                                            345
+ to 351
----------------------------------------------------------------------
+-----------------------------------
Minimum number of amino-acids present in the distant repeat is  = 5
Maximum number of amino-acids present in the distant repeat is  = 7
Total number of distant repeats found = 62
______________________________________________________________________
+___________________________________
INPUT SEQUENCE=6619
>Q9RKU5|ALN_STRCO Probable allantoinase - Streptomyces coelicolor
MSEAELVLRSTRVITPEGTRAASVAVTGEKITAVLPYDAPVPAGARLEDVGDHVVLPGLVDTHVHVNDPG
RTEWEGFWTATRAAAAGGITTLVDMPLNSIPPTTTVDNLRTKREVAADKAHIDVGFWGGALPDNVKDLRP
LHEAGVFGFKAFLSPSGVDEFPHLDQEQLARSLAEIAAFDGLLIVHAEDPHHLAAAPQQGGPKYTHFLAS
RPRDAEDTAIATLLAQAKRFNARVHVLHLSSSDALPLIAEARADGVRVTVETCPHYLTLTAEEVPDGASE
FKCCPPIREAANQDLLWQALADGTIDCVVTDHSPSTADLKTDDFATAWGGIAGLQLSLPAMWTAARGRGL
GLEDVVRWMSERTAALVGLDARKGAIAPGHDADFAVLAPDETFTVDPAALQHRNRVTAYAGKTLYGVVKS
TWLRGERIVADGAFTDPKGQLLDRA
                                                                      
+                                                                     
+                  
Total Number of residues in the sequence =445
----------------------------------------------------------------------
+-----------------------------------
Number of residues in the repeat = 5
AAAAG                                                               83
+ to 87
AAAGG                                                               84
+ to 88
PSTAD                                                              314
+ to 318
----------------------------------------------------------------------
+-----------------------------------
Number of residues in the repeat = 6
AAAGGI                                                              84
+ to 89
SSSDAL                                                             240
+ to 245
----------------------------------------------------------------------
+-----------------------------------
Minimum number of amino-acids present in the distant repeat is  = 5
Maximum number of amino-acids present in the distant repeat is  = 8
Total number of distant repeats found = 94
______________________________________________________________________
+___________________________________

[download]

In reply to split of files by boby

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.