hi all, i have written a program to seperate strings from a data file. the problem is, i am getting duplicates of the original copy of the strings. i tried removing it, but in vain.....well, here is my program, 
open (PIR,'/home/sampir.txt');
while (<PIR>)
{
    if (/^ENTRY/)    {$entry = $_;}
    elsif(/^TITLE/)    {$title = (s/                   /\n\t\t /g,$_);
+}
    elsif(/^ORGANISM/){$org = (s/                   /\n\t\t /g,$_);}
    elsif(/^ACCESSIONS/){$acc = $_;}
    else
    {    
        @arr = $_;
    }
    if (defined $array2[0])
    {
        @array = split('',$arr[0]);
    }
    
}
print @array;

[download]
and this is the sample data file: 
ENTRY            CCHU       #type complete
TITLE            cytochrome c [validated] - human
ORGANISM         #formal_name Homo sapiens #common_name man
ACCESSIONS       A31764; A05676; I55192; A00001
MGDVEKGKKIFIMKCSQCHTVEMGDVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTL
+MEYLENPKKYIP
ENTRY            CCCZ       #type complete
TITLE            cytochrome c - chimpanzee (tentative sequence)
ORGANISM         #formal_name Pan troglodytes #common_name chimpanzee
ACCESSIONS       A00002
GDVEKGKKIFIMKCSQCHTVEKGSSSKHKSSSTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGED
ENTRY            CCMQR      #type complete
TITLE            cytochrome c - rhesus macaque (tentative sequence)
ORGANISM         #formal_name Macaca mulatta #common_name rhesus macaq
+ue
ACCESSIONS       A00003
GDVEKGKKIFIMKCSQCHTVEKGGSSSSKHKTGPNLHGLFGAAAAAAAARKTGQAPGYSYTAANKSSSSN
+KGITWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEE
ENTRY            CCMKP      #type complete
TITLE            cytochrome c - spider monkey
ORGANISM         #formal_name Ateles sp. #common_name spider monkey
ACCESSIONS       A00004
GDVFKGKRIFIMKCSQCHTVESSSSKGGKHKTGPNLHGLFGSSSSSSSSSSR

[download]
I refered perldoc and i tried using, 
    my @unique = ();
    my %seen   = ();
        foreach my $elem ( @array )
        {
        next if $seen{ $elem }++;
        push @unique, $elem;
        }

[download]
But what it does is, it removes the alphabets which repeats within the string.i dont want that to happen,i want all the 4 strings(the one which is next to accession line) in an array without duplicate strings. Plz help me out. thanks.

In reply to how to remove duplicate strings? by heidi

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.