Hi,
I've been getting protein sequences from the NCBI for years using code like this:
use LWP;
use HTTP::Request::Common;
my $ua = new LWP::UserAgent;
my $result = $ua->request(GET
"http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=protein&qty=1&start
+=1&list_uids=148261691&dopt=fasta");
if($result->is_success){
$fasta = $result->content;
}
# then parse $fasta to get out just my protein sequence
However, this no longer works as the NCBI have started using javascript. If you copy in the url above and view the page source you'll see what I mean - the sequence is no longer visible in the page source. The sequence should start
>gi|148261691|ref|YP_001235818.1| CheA signal transduction histidine kinase Acidiphilium cryptum JF-5
MTGGGSMDPMAEIRETFFQECEEQLAELESGLMRMEAGETDSETVNAVFRAVHSIKGGAGAFGLEDLVHF
Can anyone tell me how to get my sequences now?
Thanks,
Becky
Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
Read Where should I post X? if you're not absolutely sure you're posting in the right place.
Please read these before you post! —
Posts may use any of the Perl Monks Approved HTML tags:
- a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
| |
For: |
|
Use: |
| & | | & |
| < | | < |
| > | | > |
| [ | | [ |
| ] | | ] |
Link using PerlMonks shortcuts! What shortcuts can I use for linking?
See Writeup Formatting Tips and other pages linked from there for more info.