Re^2: REGEX help

One must be the volunteer. So i forced a cpanm install and only added a my you forgot. Unfortunately the script crashed the hard way:

------------- EXCEPTION -------------
MSG: Failed validation of sequence '[unidentified sequence]'. Invalid 
+characters were:    
STACK Bio::PrimarySeq::validate_seq /Users/karl/perl5/perlbrew/perls/p
+erl-5.24.1threads/lib/site_perl/5.24.1/Bio/PrimarySeq.pm:338
STACK Bio::PrimarySeq::_set_seq_by_ref /Users/karl/perl5/perlbrew/perl
+s/perl-5.24.1threads/lib/site_perl/5.24.1/Bio/PrimarySeq.pm:287
STACK Bio::PrimarySeq::seq /Users/karl/perl5/perlbrew/perls/perl-5.24.
+1threads/lib/site_perl/5.24.1/Bio/PrimarySeq.pm:272
STACK Bio::PrimarySeq::new /Users/karl/perl5/perlbrew/perls/perl-5.24.
+1threads/lib/site_perl/5.24.1/Bio/PrimarySeq.pm:229
STACK Bio::Seq::new /Users/karl/perl5/perlbrew/perls/perl-5.24.1thread
+s/lib/site_perl/5.24.1/Bio/Seq.pm:496
STACK toplevel ./bio.pl:16
-------------------------------------
[download]

Just for curiosity. Anyway - too bad. This stuff is PITA...

Best regards, Karl

ŤThe Crux of the Biscuit is the Apostropheť

perl -MCrypt::CBC -E 'say Crypt::CBC->new(-key=>'kgb',-cipher=>"Blowfish")->decrypt_hex($ENV{KARL});'Help

Comment on Re^2: REGEX help Select or Download Code

Replies are listed 'Best First'.
Re^3: REGEX help by poj (Abbot) on Apr 21, 2018 at 17:17 UTC
Take the spaces out of `$letters` and you should get `$prot_object = bless( { 'primary_seq' => bless( { 'length' => 63, '_root_verbose' => 0 +, '_nowarnonempty' => +undef, 'seq' => 'MGPTSQPTLH +PQNHAGIGLRKGKHLCVAYEPFLYLLLSQQGRKREEAAVERIRLREVGISLL*', 'alphabet' => 'prote +in' }, 'Bio::PrimarySeq' ) +, '_root_verbose' => 0 }, 'Bio::Seq' );` [download] whatever that means ! poj	[reply] [d/l] [select]
Re^4: REGEX help by dorko (Prior) on Apr 21, 2018 at 19:31 UTC
karlgoethebier and poj, Thank you for cleaning up my mess and throwing the code over the finish line. Cheers, Brent -- Yeah, I'm a Delt.	[reply]
Re^5: REGEX help by Your Mother (Archbishop) on Apr 21, 2018 at 20:04 UTC
Why are you so mad, Bront? It's good code, Brant. (Appologies to Brent and WeRateDogs™)	[reply]
Re^6: REGEX help by dorko (Prior) on Apr 21, 2018 at 20:36 UTC
Re^7: REGEX help by Your Mother (Archbishop) on Apr 21, 2018 at 20:56 UTC
Some notes below your chosen depth have not been shown here
Re^6: REGEX help by soonix (Chancellor) on Apr 21, 2018 at 20:35 UTC
Re^5: REGEX help by karlgoethebier (Abbot) on Apr 22, 2018 at 08:16 UTC
Forget about the mess and let' go for a sunday roast bro. Best regards, Karl ŤThe Crux of the Biscuit is the Apostropheť `perl -MCrypt::CBC -E 'say Crypt::CBC->new(-key=>'kgb',-cipher=>"Blowfish")->decrypt_hex($ENV{KARL});'`Help	[reply] [d/l]
Re^4: REGEX help by karlgoethebier (Abbot) on Apr 21, 2018 at 19:22 UTC
"Take the spaces out...whatever..." D'oh! Thanks and best regards, Karl ŤThe Crux of the Biscuit is the Apostropheť `perl -MCrypt::CBC -E 'say Crypt::CBC->new(-key=>'kgb',-cipher=>"Blowfish")->decrypt_hex($ENV{KARL});'`Help	[reply] [d/l]