Dear All, I am wiling to aumtomate a website using LWP. But the output is error message "Moved Temporarily". My program is as follows: 
********************************************
#!/usr/bin/perl

my $URLtoPostTo="http://tools.immuneepitope.org/tools/bcell/bcell_Pred
+iction";


my %Fields = (
   "swId"  =>  "P02185",
   "sequence" => ">sp|P02185|MYG_PHYCA Myoglobin OS=Physeter catodon G
+N=MB PE=1 SV=2
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE
DLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGDFGADAQGAMNKALELFRKDIAAKYKELGYQG",
   "method" => '5'
);

use strict;
use LWP::UserAgent;
use HTTP::Request::Common;

my $Browser = new LWP::UserAgent;
if($BrowserName) { $Browser->agent($BrowserName); }

my $Page = $Browser->request(POST $URLtoPostTo,\%Fields);

if ($Page->is_success)
{
        print $Page->content;
}
else
{
        print "HTTP request failure \n";
        print $Page->message;
}

**********************************************************

[download]

Please let me know if there is any solution for this program. I am not able to find out.

In reply to LWP problem by perl.crazy

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.