hello perlmonks, recently I encount with a problem. The program script as following. My system is windows xp.

use strict;
use LWP;
my $protein = "MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI";
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  'http://dis.embl.de/cgiDict.py',
   # That's the URL that the real form submits to.
  [
'key' => "process",
'SP_entry' => "",
'sequence_string' => $protein,
'smooth_frame' => "8",
'peak_frame' => "8",
'join_frame' => "4",
'fold_coils' => "1.20",
'fold_rem465' => "1.20",
'fold_hotloops' => "1.40",
'plot_title' => "",
'doApplet' => "true",
'tango_PH' => "7.40",
'tango_T' => "298.15",
'tango_I' => "0.02",
'tango_TFE' => "0.00",
'fold_tango' => "1.00",
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 
open(FILE, '>D:\perl\tmp2.html') || die "Can't write-open out_file: $!
+";
my $dat=$response->content;
      print FILE $dat;
      close FILE;
      system('C:\Program Files\Internet Explorer\IEXPLORE.EXE','D:\per
+l\tmp2.html');

[download]

When I run this script, always don't show the correct picture as I wish. The place should show the picture always appear the sentence “plots are not rendered as ASCII art”.
Maybe you can visit the website "http://dis.embl.de/cgiDict.py" and then paste the protein sequence "MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSI".
You will watch the webpage what I want to. The black picture is absent from my file instead of a sentence mensioned above.
what shoud I do? Thanks in advance.

In reply to what's "plots are not rendered as ASCII art" ? by genbank

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.