The chart (black picture) that is just above the text "Download PostScript file" is an interactive Java applet; notice that numbers in the legend (upper-right corner) change as you move your cursor across the chart.

Perhaps you could configure that applet to run locally, to achieve the same result after downloading the page? I am not sure what you intend, and this problem is not caused by Perl; you would get the same result with `wget` or `curl`.

Alternately, you could download the (non-interactive) chart as Encapsulated PostScript, and view it without an applet (although you will need the free Win32 Postscript programs GhostScript and GhostView.
This code works for me:

use strict;
use warnings;
use LWP;
my $base_url = 'http://dis.embl.de';
my $protein = 'MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI';
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  "$base_url/cgiDict.py", # That's the URL that the real form submits 
+to.
  [
    key             => 'process',
    SP_entry        => '',
    sequence_string => $protein,
    smooth_frame    => '8',
    peak_frame      => '8',
    join_frame      => '4',
    fold_coils      => '1.20',
    fold_rem465     => '1.20',
    fold_hotloops   => '1.40',
    plot_title      => '',
    doApplet        => 'true',
    tango_PH        => 7.40,
    tango_T         => 298.15,
    tango_I         => 0.02,
    tango_TFE       => 0.00,
    fold_tango      => 1.00,
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $html = $response->content;
my ($eps) = ( $html =~ m{<a href="([^"]+)">Download PostScript file</a
+>} )
  or die;

$response = $browser->get("$base_url/$eps");
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $out_path = 'tmp.eps';
open my $out_fh, '>', $out_path
  or die "Can't write-open out_file: $!";
print {$out_fh} $response->content;
close $out_fh;
system( 'C:/Program Files/Ghostgum/gsview/gsview32.exe', $out_path );
[download]

Yeah, it's not a simple picture. This script you provided is so great. However I want to show the webpage normally including the "black chart".




what about the script as following?




use strict;
use LWP;
my $protein = "MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI";
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  'http://dis.embl.de/cgiDict.py',
   # That's the URL that the real form submits to.
  [
'key' => "process",
'SP_entry' => "",
'sequence_string' => $protein,
'smooth_frame' => "8",
'peak_frame' => "8",
'join_frame' => "4",
'fold_coils' => "1.20",
'fold_rem465' => "1.20",
'fold_hotloops' => "1.40",
'plot_title' => "",
'doApplet' => "true",
'tango_PH' => "7.40",
'tango_T' => "298.15",
'tango_I' => "0.02",
'tango_TFE' => "0.00",
'fold_tango' => "1.00",
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 
open(FILE, '>D:\perl\tmp2.html') || die "Can't write-open out_file: $!
+";
my $dat=$response->content;
      $dat=~s/"\//"http:\/\/dis.embl.de\//g;
      print FILE $dat;
      close FILE;
      system('C:\Program Files\Internet Explorer\IEXPLORE.EXE','D:\per
+l\tmp2.html');
[download]




This script can make the "black chart" correctly show up at the tmp2.html. The difference between the two script I post is "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". But I don't know what's the function of "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". Could you give me a explanation? Thanks a lot!

But I don't know what's the function of "$dat=~s/"\//"http:\/\/dis.embl.de\//g;"

It substitutes "/ with "http://dis.embl.de/, which presumably has the effect that IE will fetch URIs affected by the substitution remotely instead of trying to load them from your local disk (where tmp2.html resides).

For example:

my $dat = '<img src="/foo.jpg">';

$dat=~s/"\//"http:\/\/dis.embl.de\//g;

print $dat;   # <img src="http://dis.embl.de/foo.jpg">
[download]

At least you need to throw in a <base> element. Or, if the goal is to show the page in a browser, make a GET URL, and start the browser with that URL.

Thanks a lot!

what shoud I do?

Try downloading the image instead of some broken html

after all, img inside applet isn't exactly valid html

It so is valid. The applet element works the same way as the object element: content inside is fallback if the applet cannot be rendered (because eg. the browser doesn't have the right plugin to view it).