in reply to what's "plots are not rendered as ASCII art" ?

The chart (black picture) that is just above the text "Download PostScript file" is an interactive Java applet; notice that numbers in the legend (upper-right corner) change as you move your cursor across the chart.

Perhaps you could configure that applet to run locally, to achieve the same result after downloading the page? I am not sure what you intend, and this problem is not caused by Perl; you would get the same result with `wget` or `curl`.

Alternately, you could download the (non-interactive) chart as Encapsulated PostScript, and view it without an applet (although you will need the free Win32 Postscript programs GhostScript and GhostView.
This code works for me: 

use strict;
use warnings;
use LWP;
my $base_url = 'http://dis.embl.de';
my $protein = 'MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI';
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  "$base_url/cgiDict.py", # That's the URL that the real form submits 
+to.
  [
    key             => 'process',
    SP_entry        => '',
    sequence_string => $protein,
    smooth_frame    => '8',
    peak_frame      => '8',
    join_frame      => '4',
    fold_coils      => '1.20',
    fold_rem465     => '1.20',
    fold_hotloops   => '1.40',
    plot_title      => '',
    doApplet        => 'true',
    tango_PH        => 7.40,
    tango_T         => 298.15,
    tango_I         => 0.02,
    tango_TFE       => 0.00,
    fold_tango      => 1.00,
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $html = $response->content;
my ($eps) = ( $html =~ m{<a href="([^"]+)">Download PostScript file</a
+>} )
  or die;

$response = $browser->get("$base_url/$eps");
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $out_path = 'tmp.eps';
open my $out_fh, '>', $out_path
  or die "Can't write-open out_file: $!";
print {$out_fh} $response->content;
close $out_fh;
system( 'C:/Program Files/Ghostgum/gsview/gsview32.exe', $out_path );

[download]

Replies are listed 'Best First'.
Re^2: what's "plots are not rendered as ASCII art" ?
by genbank (Novice) on Apr 15, 2011 at 05:09 UTC

    Yeah, it's not a simple picture. This script you provided is so great. However I want to show the webpage normally including the "black chart".


    what about the script as following?


    use strict;
use LWP;
my $protein = "MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI";
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  'http://dis.embl.de/cgiDict.py',
   # That's the URL that the real form submits to.
  [
'key' => "process",
'SP_entry' => "",
'sequence_string' => $protein,
'smooth_frame' => "8",
'peak_frame' => "8",
'join_frame' => "4",
'fold_coils' => "1.20",
'fold_rem465' => "1.20",
'fold_hotloops' => "1.40",
'plot_title' => "",
'doApplet' => "true",
'tango_PH' => "7.40",
'tango_T' => "298.15",
'tango_I' => "0.02",
'tango_TFE' => "0.00",
'fold_tango' => "1.00",
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 
open(FILE, '>D:\perl\tmp2.html') || die "Can't write-open out_file: $!
+";
my $dat=$response->content;
      $dat=~s/"\//"http:\/\/dis.embl.de\//g;
      print FILE $dat;
      close FILE;
      system('C:\Program Files\Internet Explorer\IEXPLORE.EXE','D:\per
+l\tmp2.html');

    [download]

    This script can make the "black chart" correctly show up at the tmp2.html. The difference between the two script I post is "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". But I don't know what's the function of "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". Could you give me a explanation? Thanks a lot!

[reply]
[d/l]
      But I don't know what's the function of "$dat=~s/"\//"http:\/\/dis.embl.de\//g;"

      It substitutes "/ with "http://dis.embl.de/, which presumably has the effect that IE will fetch URIs affected by the substitution remotely instead of trying to load them from your local disk (where tmp2.html resides).

      For example: 

      my $dat = '<img src="/foo.jpg">';

$dat=~s/"\//"http:\/\/dis.embl.de\//g;

print $dat;   # <img src="http://dis.embl.de/foo.jpg">

      [download]
[reply]
[d/l]
[select]
        Wow, thank you very much! I have understood. Thanks again!
[reply]

In Section Seekers of Perl Wisdom