Re^2: what's "plots are not rendered as ASCII art" ?

Yeah, it's not a simple picture. This script you provided is so great. However I want to show the webpage normally including the "black chart".

what about the script as following?

use strict;
use LWP;
my $protein = "MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI";
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  'http://dis.embl.de/cgiDict.py',
   # That's the URL that the real form submits to.
  [
'key' => "process",
'SP_entry' => "",
'sequence_string' => $protein,
'smooth_frame' => "8",
'peak_frame' => "8",
'join_frame' => "4",
'fold_coils' => "1.20",
'fold_rem465' => "1.20",
'fold_hotloops' => "1.40",
'plot_title' => "",
'doApplet' => "true",
'tango_PH' => "7.40",
'tango_T' => "298.15",
'tango_I' => "0.02",
'tango_TFE' => "0.00",
'fold_tango' => "1.00",
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 
open(FILE, '>D:\perl\tmp2.html') || die "Can't write-open out_file: $!
+";
my $dat=$response->content;
      $dat=~s/"\//"http:\/\/dis.embl.de\//g;
      print FILE $dat;
      close FILE;
      system('C:\Program Files\Internet Explorer\IEXPLORE.EXE','D:\per
+l\tmp2.html');
[download]

This script can make the "black chart" correctly show up at the tmp2.html. The difference between the two script I post is "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". But I don't know what's the function of "$dat=~s/"\//"http:\/\/dis.embl.de\//g;". Could you give me a explanation? Thanks a lot!

Comment on Re^2: what's "plots are not rendered as ASCII art" ? Download Code

Replies are listed 'Best First'.
Re^3: what's "plots are not rendered as ASCII art" ? by Eliya (Vicar) on Apr 15, 2011 at 08:47 UTC
But I don't know what's the function of `"$dat=~s/"\//"http:\/\/dis.embl.de\//g;"` It substitutes `"/` with `"http://dis.embl.de/`, which presumably has the effect that IE will fetch URIs affected by the substitution remotely instead of trying to load them from your local disk (where `tmp2.html` resides). For example: `my $dat = '<img src="/foo.jpg">'; $dat=~s/"\//"http:\/\/dis.embl.de\//g; print $dat; # <img src="http://dis.embl.de/foo.jpg">` [download]	[reply] [d/l] [select]
Re^4: what's "plots are not rendered as ASCII art" ? by genbank (Novice) on Apr 15, 2011 at 11:50 UTC
Wow, thank you very much! I have understood. Thanks again!	[reply]