The chart (black picture) that is just above the text "Download PostScript file" is an interactive Java applet; notice that numbers in the legend (upper-right corner) change as you move your cursor across the chart.

Perhaps you could configure that applet to run locally, to achieve the same result after downloading the page? I am not sure what you intend, and this problem is not caused by Perl; you would get the same result with `wget` or `curl`.

Alternately, you could download the (non-interactive) chart as Encapsulated PostScript, and view it without an applet (although you will need the free Win32 Postscript programs GhostScript and GhostView.
This code works for me: 

use strict;
use warnings;
use LWP;
my $base_url = 'http://dis.embl.de';
my $protein = 'MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGE
+RLTSI';
my $browser = LWP::UserAgent->new;
$browser->env_proxy();
my $response = $browser->post(
  "$base_url/cgiDict.py", # That's the URL that the real form submits 
+to.
  [
    key             => 'process',
    SP_entry        => '',
    sequence_string => $protein,
    smooth_frame    => '8',
    peak_frame      => '8',
    join_frame      => '4',
    fold_coils      => '1.20',
    fold_rem465     => '1.20',
    fold_hotloops   => '1.40',
    plot_title      => '',
    doApplet        => 'true',
    tango_PH        => 7.40,
    tango_T         => 298.15,
    tango_I         => 0.02,
    tango_TFE       => 0.00,
    fold_tango      => 1.00,
  ] 
);
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $html = $response->content;
my ($eps) = ( $html =~ m{<a href="([^"]+)">Download PostScript file</a
+>} )
  or die;

$response = $browser->get("$base_url/$eps");
die "Error: ", $response->status_line, "\n"
 unless $response->is_success; 

my $out_path = 'tmp.eps';
open my $out_fh, '>', $out_path
  or die "Can't write-open out_file: $!";
print {$out_fh} $response->content;
close $out_fh;
system( 'C:/Program Files/Ghostgum/gsview/gsview32.exe', $out_path );

[download]

In reply to Re: what's "plots are not rendered as ASCII art" ? by Util
in thread what's "plots are not rendered as ASCII art" ? by genbank

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post, it's "PerlMonks-approved HTML":


  • Posts are HTML formatted. Put <p> </p> tags around your paragraphs. Put <code> </code> tags around your code and data!
  • Titles consisting of a single word are discouraged, and in most cases are disallowed outright.
  • Read Where should I post X? if you're not absolutely sure you're posting in the right place.
  • Please read these before you post! —
  • Posts may use any of the Perl Monks Approved HTML tags:
    a, abbr, b, big, blockquote, br, caption, center, col, colgroup, dd, del, details, div, dl, dt, em, font, h1, h2, h3, h4, h5, h6, hr, i, ins, li, ol, p, pre, readmore, small, span, spoiler, strike, strong, sub, summary, sup, table, tbody, td, tfoot, th, thead, tr, tt, u, ul, wbr
  • You may need to use entities for some characters, as follows. (Exception: Within code tags, you can put the characters literally.)
            For:     Use:
    & &amp;
    < &lt;
    > &gt;
    [ &#91;
    ] &#93;
  • Link using PerlMonks shortcuts! What shortcuts can I use for linking?
  • See Writeup Formatting Tips and other pages linked from there for more info.