Beefy Boxes and Bandwidth Generously Provided by pair Networks
Problems? Is your data what you think it is?
 
PerlMonks  

comment on

( [id://3333]=superdoc: print w/replies, xml ) Need Help??

Here's another option:

use strict; use warnings; local $/ = '>'; while (<>) { chomp; /\S/ or next; my ( $id, $seq ) = /(.+?)\n(.+)/s; $seq =~ s/\n//g; my $GCcount = $seq =~ tr/GC//; printf "%s, %.2f%%\n", ">$id", ( $GCcount / length $seq ) * 100; }

Command-line usage: perl script.pl fastaFile [>outfile]

The last, optional parameter directs output to a file.

Sample FASTA record:

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENY

Output on that sample FASTA record:

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus], 7.3 +9%

Since FASTA files use ">" as the record separator, the script sets Perl's record separator to that character, so the file's read one FASTA record at a time. After a read, chomp removes that record separator.

Next, /\s/ tests to see that there are characters to parse and, if not, the next record is read. Using a regex, the id and seq are captured. A substitution is used to remove any newlines, so an accurate length count can be made. (The sequence in FASTA records may be across multiple lines; this script will handle these.)

As AnomalousMonk demonstrated, Perl's transliteration operator can be used to get the GC character count within the sequence. Finally, the results are printed using printf.

Hope this helps!


In reply to Re: Problem computing GC content by Kenosis
in thread Problem computing GC content by zuepinhel

Title:
Use:  <p> text here (a paragraph) </p>
and:  <code> code here </code>
to format your post; it's "PerlMonks-approved HTML":



  • Are you posting in the right place? Check out Where do I post X? to know for sure.
  • Posts may use any of the Perl Monks Approved HTML tags. Currently these include the following:
    <code> <a> <b> <big> <blockquote> <br /> <dd> <dl> <dt> <em> <font> <h1> <h2> <h3> <h4> <h5> <h6> <hr /> <i> <li> <nbsp> <ol> <p> <small> <strike> <strong> <sub> <sup> <table> <td> <th> <tr> <tt> <u> <ul>
  • Snippets of code should be wrapped in <code> tags not <pre> tags. In fact, <pre> tags should generally be avoided. If they must be used, extreme care should be taken to ensure that their contents do not have long lines (<70 chars), in order to prevent horizontal scrolling (and possible janitor intervention).
  • Want more info? How to link or How to display code and escape characters are good places to start.
Log In?
Username:
Password:

What's my password?
Create A New User
Domain Nodelet?
Chatterbox?
and the web crawler heard nothing...

How do I use this?Last hourOther CB clients
Other Users?
Others wandering the Monastery: (2)
As of 2024-04-26 02:30 GMT
Sections?
Information?
Find Nodes?
Leftovers?
    Voting Booth?

    No recent polls found